PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00024722-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 313aa    MW: 34309.6 Da    PI: 10.2981
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00024722-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.4e-12106150347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+    ++Rt+ q+ s+ qky
  WALNUT_00024722-RA 106 PWTEEEHRTFLIGLEKLGKGDWRGISINYVTTRTPTQVASHAQKY 150
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.878320IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.102.5E-4422IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.8299155IPR017930Myb domain
SuperFamilySSF466894.56E-17100155IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-17102154IPR006447Myb domain, plants
SMARTSM007172.1E-8103153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-10103149IPR009057Homeodomain-like
PfamPF002493.0E-10106150IPR001005SANT/Myb domain
CDDcd001672.82E-8106151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRKCSHCGN EGHNSRTCTS NRGTFAGGLK LFGVQLDLSS SSVAMKRSFS MDCLYSSSPS  60
SLSSPPSSLS SSRISTDKNS DKTRIGYLSD GLTGRVRPQE RKKGVPWTEE EHRTFLIGLE  120
KLGKGDWRGI SINYVTTRTP TQVASHAQKY FLRQASLDMK KKRRSSLFDM VGSSNMAGQS  180
NESCNPKQRV PVSTGYAFGH KVHLNTSSTI DPLLGLSRSE HFESKNQETV WLYGLIDSHL  240
MMNTSNAAKP SSPNAAVLPN LELTLAAPRP LEQINHPQNP FISAYSLTNS RINHGNDYPA  300
ALMVPVATPS RRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159163KKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012873.11e-94Myb-like transcription factor family protein, putative
TrEMBLA0A061GMU92e-94A0A061GMU9_THECC; Myb-like transcription factor family protein, putative
STRINGVIT_11s0016g02410.t011e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-56MYB_related family protein